PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0086s0160.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 601aa    MW: 65855 Da    PI: 6.8268
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0086s0160.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.91.7e-085195571854
                             HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             +F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  SapurV1A.0086s0160.1.p 519 MFQNflHPYPKDAEKHLLAVKSGLTRSQVSNWFINARVR 557
                             5887779******************************88 PP

2BELL78.59.5e-26391460272
                    BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                             +++l++k+++Ll+ll+ Vd+rY+q+ ++++tvis+F+a+++l++ +++t++Al++iS+  + L+d+i++qi
  SapurV1A.0086s0160.1.p 391 KRALEAKRTQLLTLLQVVDERYSQCLDEIHTVISAFHAATELDP-QIHTRFALQTISFLCKRLRDRISNQI 460
                             6899****************************************.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.2E-24308458IPR006563POX domain
PfamPF075267.5E-26313457IPR006563POX domain
CDDcd000863.22E-11501561No hitNo description
SMARTSM003892.2E-5501565IPR001356Homeobox domain
SuperFamilySSF466896.84E-15503570IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-25504567IPR009057Homeodomain-like
PfamPF059209.7E-15518557IPR008422Homeobox KN domain
PROSITE profilePS5007110.851520561IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MHDIMENGLF GVPIDVPGRN SVATDRSSQR APNSPVQFDS FNLNNHSQTV GGFTMLPALQ  60
GEPISDLPAS FHISNRSSVM NSEAFVTSLG RNLSGDALPG CPRSISNTSF DEQFGGGTAI  120
SSSAIATLLA TRSGLQENLN NLAISGPSSY PLDDFRSFVS NDCANALSSS FASSLNYGCG  180
EVFGNLTGKE DIDRFPAPVD LGRTPVRAGF QPYSSIGSLQ LNSWIEPNGV NVSSGDPFAS  240
GKPTNELSLS LATSQPSIID RRSVPDRCSE ISCNHVTCHC LKETRLGAAQ TSCSSKELSL  300
GCNSYKAGQF SQVIVGSRYL HVIQEILAKI ASYSLENVDQ ISSSTAWFKI GAGTPFSPSY  360
PTEGGMLLMG SDESPGVNGR FEVPMDPALQ KRALEAKRTQ LLTLLQVVDE RYSQCLDEIH  420
TVISAFHAAT ELDPQIHTRF ALQTISFLCK RLRDRISNQI LALGAQLDSG DTRDMEGSFE  480
SSYLQKQWTL QQLKKKDHPL WRPQRGLPER SVSVLRAWMF QNFLHPYPKD AEKHLLAVKS  540
GLTRSQVSNW FINARVRLWK PLIEEMYAEM NRRQALQIEE GTYSNHRGQI SISNPRFNVN  600
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A1e-14507565563Homeobox protein Meis2
4xrm_B1e-14507565563Homeobox protein Meis2
4xrs_A1e-14507564158Homeobox protein Meis1
4xrs_B1e-14507564158Homeobox protein Meis1
5bng_A1e-14507565159Homeobox protein Meis2
5bng_B1e-14507565159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011019491.10.0PREDICTED: homeobox protein ATH1-like
RefseqXP_011019490.10.0PREDICTED: homeobox protein ATH1-like
RefseqXP_011019489.10.0PREDICTED: homeobox protein ATH1-like
RefseqXP_011019488.10.0PREDICTED: homeobox protein ATH1-like
RefseqXP_011019487.10.0PREDICTED: homeobox protein ATH1-like
RefseqXP_011019486.10.0PREDICTED: homeobox protein ATH1-like
SwissprotP487311e-115ATH1_ARATH; Homeobox protein ATH1
TrEMBLB9HDP10.0B9HDP1_POPTR; Uncharacterized protein
STRINGPOPTR_0006s24680.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59393249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.11e-110homeobox gene 1